If you have been reading about lyophilization and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-04-20. Numbers and descriptions here follow the published literature rather than marketing material.
Regulatory status varies sharply by country. Semax is registered for medical use in Russia, where it appears in formularies as a nasal solution, and it also holds registration in a small number of neighbouring states. It has no approval from the United States Food and Drug Administration or the European Medicines Agency, and it is not a scheduled controlled substance in most jurisdictions. Elsewhere it circulates mainly as laboratory material, so purity documentation comes from suppliers rather than from a national pharmacopoeia.
Semax is a synthetic peptide created in the Soviet Union during the early 1980s by researchers working in Moscow. It was built from the short adrenocorticotropic hormone fragment known as ACTH(4-10), and the chain was then extended with three additional amino acids. The resulting molecule was named semax and entered clinical use in Russia in 1994. It is generally described as a nootropic and neuroprotective agent rather than as a hormone analogue.
The parent fragment ACTH(4-10) carries the sequence Met-Glu-His-Phe-Arg-Trp-Gly. Semax replaces the arginine and tryptophan positions with a proline-glycine-proline tail, giving Met-Glu-His-Phe-Pro-Gly-Pro. That change removes residues associated with adrenal stimulation, so the peptide does not drive cortisol release the way full ACTH does. This distinction shapes how the compound is grouped in the literature, where it sits with neuropeptides and peptide neuromodulators rather than with corticosteroids.
Published research has focused mainly on neurological and cognitive endpoints in animal models, with proposed mechanisms involving brain-derived neurotrophic factor and related signalling pathways. A substantial share of the human data originates from a limited number of research groups, and independent replication in other countries remains sparse. Regulatory status reflects that distribution: the peptide is registered as a medicine in Russia and appears in some neighbouring markets, while elsewhere it is handled as a research chemical without approved therapeutic labelling. Questions about dose-response relationships, long-term effects, and comparability across studies are still open.
Lyophilised powder is normally kept at -20 °C in a desiccated container, with some suppliers recommending -80 °C for long-term archival storage. Repeated freeze-thaw cycles are the most common cause of avoidable loss, so aliquoting before freezing reduces variability between working sessions. Dissolved peptide is far less stable than the dry solid and is usually prepared fresh or held briefly at 4 °C. Aqueous solutions support both hydrolysis of the backbone and oxidation of the N-terminal methionine, and these two routes dominate degradation under ordinary laboratory conditions.
Identity and purity are confirmed with reversed-phase high-performance liquid chromatography, typically monitored at 214 nanometres where the peptide bond absorbs. Mass spectrometry, either electrospray or MALDI-TOF, verifies molecular mass against the theoretical value and detects truncation or adduct formation. Amino acid analysis and peptide mapping provide additional confirmation when required. The most frequently reported impurities are deletion sequences from incomplete coupling, methionine sulfoxide from oxidation, and dimeric species formed through non-covalent aggregation. Impurity profiles depend strongly on the synthesis and purification route chosen by the producer.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic heptapeptide | Analogue of the ACTH(4-10) fragment |
| Amino acid sequence | Met-Glu-His-Phe-Pro-Gly-Pro | Single-letter form MEHFPGP |
| Molecular formula | C37H51N9O10S | Free peptide, nominal mass near 814 Da |
| First registration | 1994, Russia | Nasal formulation for neurological indications |
| Typical purity grade | 95% or higher by HPLC | Research material; higher grades used as reference standards |
The C-terminal Pro-Gly-Pro extension is not incidental. Proline-rich tails are known to resist several common peptidases, and the published literature attributes the longer half-life of Semax, relative to unmodified ACTH fragments, to this feature. The modification also removes the melanocyte-stimulating and corticosteroidogenic activity that characterizes longer ACTH-derived sequences. Because the molecule is small and hydrophilic, it is typically formulated as an aqueous solution for intranasal or parenteral delivery. Acetylation or amidation at the termini appears in closely related research peptides and shifts the mass by a fixed increment.
Reported pharmacological work centers on neurotrophic signaling, including changes in BDNF and NGF expression in hippocampal tissue in animal models. Human data come largely from studies conducted in Russia, and how well those results generalize to other populations remains an open question. Regulatory status differs sharply by jurisdiction: Semax is a registered prescription medicine in Russia, while it holds no approved marketing status in the United States or the European Union. Outside such jurisdictions it is generally handled as a research chemical, which affects both documentation and quality expectations.
Semax is a synthetic heptapeptide whose sequence is Met-Glu-His-Phe-Pro-Gly-Pro. It was developed as a fragment analog of adrenocorticotropic hormone, modeled specifically on the ACTH(4-10) region. The first four residues reproduce that fragment, while a Pro-Gly-Pro tripeptide is appended at the C-terminus. Work on the compound originated in Russia, where it entered clinical use as an intranasal preparation. Its sequence places it among short regulatory peptides studied for effects on the central nervous system rather than on the adrenal axis.
Lyophilized material is chemically stable for extended periods when kept dry, cold, and protected from light. The powder is hygroscopic, so vials should be warmed to room temperature before opening to reduce condensation on the contents. Once dissolved, the peptide is far less stable because peptide bonds are susceptible to hydrolysis and the methionine residue can oxidize. Solutions are typically aliquoted and held at 2-8 °C for short intervals or frozen for longer ones, and repeated freeze-thaw cycles should be avoided.
Routine characterization relies on reversed-phase high-performance liquid chromatography to establish purity and on mass spectrometry to confirm molecular identity. Electrospray ionization and matrix-assisted laser desorption ionization are both used for mass verification. Amino acid analysis and peptide mapping can detect sequence errors. Common impurities include truncated sequences, methionine sulfoxide formed by oxidation, and deamidated products. Chromatograms are usually recorded near 214 nm, where the peptide backbone absorbs, and purity is reported as the percentage area of the principal peak.
Development is attributed to researchers at the Institute of Molecular Genetics in Moscow during the early 1980s, building on earlier Soviet work with ACTH fragments. Russian regulatory approval followed for intranasal use, and the compound has remained commercially available there for decades. Most published human data originate from Russian and, later, some Eastern European clinical reports, which are not always accessible in English translation. Outside that region the material is generally handled as a research chemical rather than a licensed medicine.
Regulatory status differs sharply between jurisdictions. In Russia the peptide is registered as a prescription nasal preparation, while agencies such as the United States Food and Drug Administration have not approved it for any indication. Products sold elsewhere are typically labeled for laboratory research only, and such labels shift responsibility for safe handling to the purchaser. Because the same name covers pharmaceutical-grade nasal drops and bulk research powder, identity and purity documentation becomes the main practical concern when comparing sources.
Semax is a synthetic seven-amino-acid peptide whose sequence extends the ACTH(4-10) fragment with a C-terminal proline-glycine-proline tripeptide. The commonly cited sequence is Met-Glu-His-Phe-Pro-Gly-Pro, giving a molecular formula near C37H51N9O10S and a molecular weight close to 813.9 g/mol. It belongs to the broader class of synthetic ACTH fragments studied for central nervous system effects rather than for adrenal steroid stimulation. In practice the material appears as a lyophilized white powder for laboratory work or as a dilute saline solution in clinical settings.
Proposed mechanisms center on neurotrophic signaling rather than on classical melanocortin receptor activation. Rodent experiments have reported shifts in the expression of brain-derived neurotrophic factor and nerve growth factor after administration, together with changes in the associated receptor systems. Several authors argue that the peptide acts largely through its degradation products and their interaction with peptidergic pathways, but this remains a hypothesis rather than a settled finding. No single molecular target has been identified in a way that the field broadly accepts.
Published research covers ischemic stroke, traumatic brain injury, cognitive impairment, optic nerve conditions and attention-related measures. Much of the human evidence comes from small trials conducted in one country, which limits how far the results generalize. Animal models supply the larger share of the data, and effects seen in rodents do not transfer automatically to people. Reviews have noted that methodological reporting is often incomplete, making it difficult to pool results or compare treatment schedules across studies.
Pharmacokinetic accounts emphasize rapid breakdown. After intravenous dosing the intact peptide disappears from blood within minutes, and nasal delivery produces low but measurable concentrations. Metabolites rather than the parent molecule may account for part of the observed activity, although the relative contribution is unresolved. Dosing in the literature varies widely and no optimal schedule has been agreed. These gaps are regularly cited as a reason the findings have not produced broad clinical adoption beyond the original research setting.
c. 620: Rufaida Al-Aslamia, Was recognized as the first Muslim nurse in history. c. 975: Chinese alchemist Keng Hsien-Seng was employed by the Royal Court. She distilled perfumes, utilized an early form of the Soxhlet process to extract camphor into alcohol, and gained recognition for her skill in using mercury to extract silver from ores. 10th century: Syrian scientist, mathematician, and astronomer Al-ʻIjliyyah manufactured astrolabes for the court of Sayf al-Dawla in Aleppo. 11th century: Li Shao Yun, Chinese chemist. 11th century: Zhang Xiaoniang, Chinese physician. c. 1098–1179: Hildegard of Bingen was a founder of scientific natural history in Germany. fl. 1119–1182: Sun Bu'er, Chinese chemist. fl. 1122–1131: Dobrodeia of Kiev, a Rus' princess and Empress of the Eastern Roman Empire, was the first woman to write a treatise on medicine. 1159: Alsatian nun Herrad of Landsberg (1130–1195) compiled the scientific compendium Hortus deliciarum. fl. 1176: Helvidis, French physician. fl. 1200: Rebecca Guarna, Italian physician and was known as one of the "Women of Salerno". Early 12th century: The Italian medical practitioner Trota of Salerno compiled medical works on women's ailments and skin diseases. 12th century: Adelle of the Saracens taught at the Salerno School of Medicine. fl. 1249–1259: Magistra Hersend, French surgeon. fl. 1265 Stephanie de Lyon, French physician. fl. 1291 Théophanie, French barber surgeon. fl. 1292 Denice, French barber-surgeon. fl. 1292 Isabiau la Mergesse, French-Jewish physician. fl. ca. 13th century Demud, German physician. fl.
Wiley (1844–1930), American chemist, pure food and drug advocate Sir Geoffrey Wilkinson (1921–1996), English chemist, 1973 Nobel Prize in Chemistry Alexander William Williamson (1824–1904), English chemist, famous for Williamson ether synthesis Thomas Willson (1860–1915), Canadian chemist, discovered an economically efficient process for creating calcium carbide Richard Willstätter (1872–1942), German chemist, 1915 Nobel Prize in Chemistry Adolf Otto Reinhold Windaus (1876–1959), German chemist, 1928 Nobel Prize in Chemistry Günter Wirths (1911–2005), German chemist Georg Wittig (1897–1987), German chemist, 1979 Nobel Prize in Chemistry Friedrich Wöhler (1800–1882), German chemist, best known for his synthesis of urea William Hyde Wollaston (1766–1828), English chemist, discovered the elements palladium and rhodium Robert B. Woodward (1917–1979), American chemist, 1965 Nobel Prize in Chemistry Charles de Worms (1903–1979), English chemist and lepidopterist Charles-Adolphe Wurtz (1817–1884), Alsatian French chemist, discovered the Wurtz reaction Kurt Wüthrich (born 1938), 2002 Nobel Prize in Chemistry
=== Applera === On November 30, 2000, PE Corporation changed its name to Applera, combining the two partial names Applied and Celera into one, with 5,000 employees. PE Biosystems Group was renamed once again to Applied Biosystems Group, and changed its ticker symbol from PEB to ABI. Its net revenues rose to almost US$1.4 billion. Celera that year made milestone headlines when it announced that it had completed the sequencing and first assembly of the two largest genomes in history, that of the fruit fly, and of the human. In 2001, the Applied Biosystems division of Applera reached revenues of US$1.6 billion, and developed a new workstation instrument specifically for the new field of proteomics, which had become Celera's new core business focus, as it shifted away from gene discovery. The instrument analyzed 1,000 protein samples per hour. On April 22, 2002, the Celera Genomics Group announced its decision to shift the role of marketing data from its genetic database over to its sister company, the Applied Biosystems Group. Celera would instead develop pharmaceutical drugs. Applied Biosystems was a better fit for the database, because Applied already had the huge sales force in place for the marketing of its instruments. Plans were to expand those sales and those of the database into an electronic commerce system.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
However, Erasmas and several non-avout companions, with Fraa Jad's tacit agreement, decide to seek out Orolo. After a dangerous journey over the planet's frozen pole, they reunite with Orolo at an archaeological excavation of Orithena, an ancient concent destroyed by volcanic eruption. Orolo holds philosophical discussions with Erasmas about the nature of the cosmos and consciousness, and how he believes that the aliens are not simply from another planet, but from another cosmos that is influenced by Arbre. During one of the discussions, a small spacecraft lands in Orithena on an ancient analemma symbol within the excavation. (It is later revealed that Orolo had transmitted the analemma symbol to the spaceship and anticipated the landing at Orithena.) A female alien's body is found on board, dead of a recent gunshot wound. She has brought with her four vials of blood – one for each of four alien races – and evidence about their technology. Shortly thereafter, the aliens propel a massive metal rod at the volcano, triggering an eruption that destroys Orithena. Orolo sacrifices his life to ensure the recovery of the dead alien's remains and her blood samples, an event that leads to his canonization as Saunt Orolo. Erasmas travels to Saunt Tredegarh where he attends the Convox dedicated to dealing with the military, political, and technical issues raised by the existence of the alien ship in Arbre's orbit. Research is conducted on the samples from Orithena, and the aliens are found to come from planets in four parallel and distinct cosmi: Urnud, Tro, Laterre and Fthos.
Sources: en.wikipedia.org
=== Analysis of religious justifications for the war === Nader Hashemi, director of the Alwaleed Center for Muslim-Christian Understanding, argued that religious justifications played a large role behind the war. Gregg Roman, the director of Middle East Forum, said that there are Judeo-Christian justifications being made for the war. Professor Jolyon Mitchell noted that both sides of the war profess divine favor. Abusharif said that in the United States, religious justifications for this war are the most appealing among Christian Zionists and evangelical Christians. He also said that the war is not theological, but geopolitical. However, Riaz Khokhar of Al Jazeera argued that religion plays just as much of a role in the war as strategy.
Intestinal desmosis is a medical condition implicated in gut motility disorder and chronic constipation. Desmosis can be observed as the absence of the tendinous plexus layer and connective tissue fibers.
IQSEC2: encodes an exchange factor for the Arf family of small GTP binding proteins, involved in the formation of secretory vesicles. TM4SF2: is a member of the 4 transmembrane domains family of proteins (tetraspanins, see TSPAN7). This gene is also associated with neuropsychiatric diseases such as Huntington's chorea. AP1S2: AP-1 complex subunit sigma-2. Adaptor protein complex 1 is found on the cytoplasmic face of vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. ACSL4: Long-chain-fatty-acid—CoA ligase 4 is an enzyme of the long-chain fatty-acid-coenzyme A ligase family. It converts free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. ZNF41: Zinc finger protein 41 is a likely zinc finger family transcription factor. DLG3: Disks large homolog 3, also named neuroendocrine-DLG or synapse-associated protein 102 (SAP-102). DLG3 is a member of the membrane-associated guanylate kinase (MAGUK) superfamily. FTSJ1: Transfert RNA methyltransferase 1 is a member of the S-adenosylmethionine-binding protein family. This nucleolar protein is involved in the processing and modification of tRNA. GDI1: RabGDI alpha makes a complex with geranylgeranylated small GTP-binding proteins of the Rab family and keeps them in the cytosol.
The convention elected a national committee of 33 members, with 22 seats for the majority caucus, 8 seats for Harrington's Coalition Caucus, 2 for the Debs caucus, and one for the "independent" Samuel H. Friedman. These minority caucuses all opposed the name change. The convention voted on and adopted proposals for its program by a two-one vote, with the majority caucus winning every vote.
Sources: en.wikipedia.org
On 18 February 1853, Franz Joseph survived an assassination attempt by Hungarian nationalist János Libényi. The emperor was taking a stroll with one of his officers, Count Maximilian Karl Lamoral O'Donnell, on a city bastion, when Libényi approached him. He immediately struck the emperor from behind with a knife straight at the neck. Franz Joseph almost always wore a uniform, which had a high collar that almost completely enclosed the neck. The collars of uniforms at that time were made from very sturdy material, precisely to counter this kind of attack. Even though the Emperor was wounded and bleeding, the collar saved his life. Count O'Donnell struck Libényi down with his sabre. O'Donnell, hitherto a Count only by virtue of his Irish nobility, was made a Count of the Habsburg monarchy (Reichsgraf). Another witness who happened to be nearby, the butcher Joseph Ettenreich, swiftly overpowered Libényi. For his deed he was later elevated to the nobility by the emperor and became Joseph von Ettenreich. Libényi was subsequently put on trial and condemned to death for attempted regicide. He was executed on the Simmeringer Heide. After this unsuccessful attack, the emperor's brother Archduke Ferdinand Maximilian called upon Europe's royal families for donations to construct a new church on the site of the attack. The church was to be a votive offering for the survival of the emperor. It is located on Ringstraße in the district of Alsergrund close to the University of Vienna, and is known as the Votivkirche.
Lysyl oxidase the terminal carbon of the side chain of lysyl residue side chain. The enzyme belongsthe category of quinone-containing copper amine oxidases. The reaction requires the cofactor lysyl tyrosylquinone (LTQ). The LTQ cofactor is unique among quinones because it contains an 1,2-benzoquinone substituent. Furthermore, it is neutral charge at physiological pH. The ε-amine is condenses with LTQ to give the Schiff base via reaction with LTQ. The rate-limiting removal of a ε-proton yields an imine. Subsequent hydrolysis of the imine leads to release of the allysine residue. Molecular oxygen and the copper ion are utilized to reoxidize the cofactor, producing hydrogen peroxide as a side product.
Frankincense has been traded on the Somali and Arabian Peninsula for centuries. Greek historian Herodotus wrote in The History that frankincense was harvested from trees in southern Arabia. Pliny the Elder mentioned frankincense in the Naturalis Historia. Frankincense, which was used in the Roman Empire prior to the spread of Christianity, was reintroduced to Western Europe possibly by Frankish Crusaders and other Western Europeans on their journeys to the Eastern Roman Empire, where it was commonly used in Catholic Mass. Southern Arabia was an exporter of frankincense in antiquity, with some of it being traded as far as China. The 13th-century Chinese writer and customs inspector Zhao Rugua wrote that Ruxiang or xunluxiang (Chinese: 乳香 rǔ xiāng/ 薰陸香 xūn lù xiāng) comes from the three Dashi states (Chinese: 大食 dàshí – Caliphate (Arab Muslims)) of Maloba (Murbat), Shihe (Shihr), and Nufa (Dhofar), from remote mountains; the trunk of the tree is notched with a hatchet, upon which the resin flows out, and, when hardened, turns into incense, which is gathered and made into lumps; it is transported to the Dashi ports, then on ship to Sanfoqi.
Sources: en.wikipedia.org
Registered medical products are most often 0.1% nasal drops. Research suppliers ship lyophilized powder, usually in milligram quantities, which is dissolved before use. The active peptide is the same in both cases; presentation and excipients differ.
No. The peptide is synthetic, although it is modelled on a fragment of a naturally occurring hormone. ACTH(4-10) is generated when ACTH is cleaved, but the Pro-Gly-Pro extension is not a known endogenous sequence. It is therefore a designed analogue rather than a natural metabolite.
The label reflects reported effects on attention, memory and recovery after neurological injury in regional clinical reports. Those reports are mostly small and have not been widely replicated outside the region. The classification is descriptive and does not imply a single defined mechanism.
Reversed-phase HPLC gives the main purity figure, most often with UV detection near 214 nanometres. Mass spectrometry then confirms the molecular mass. Together the two methods distinguish a correct sequence from a closely related impurity.