Melanocortin receptor is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-01-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. Its chain combines the first seven residues of corticotropin with a C-terminal proline-glycine-proline extension, a modification intended to slow enzymatic breakdown. The free peptide has a molecular mass near 813.9 daltons. It belongs to the class of ACTH-derived fragments studied for central nervous system activity rather than for adrenal steroid stimulation. This structural relationship to a natural hormone fragment is the usual starting point for describing the compound in the literature.
Development took place during the 1980s at institutes of the Russian Academy of Sciences, where peptide fragments of ACTH were screened for cognitive and neuroprotective effects. The compound received regulatory approval in Russia as a nasal preparation, marketed for conditions such as ischemic stroke, transient ischemic attacks, and optic nerve disorders. Registration in other countries has not followed. Most published clinical reports originate from a small number of Russian research groups, and independent replication outside that setting remains limited. The regulatory status therefore differs sharply between Russia and the rest of the world.
Laboratory work points toward modulation of neurotrophic signaling, particularly expression of brain-derived neurotrophic factor and nerve growth factor in hippocampal tissue. Studies also describe effects on monoamine turnover, inflammatory mediators, and oxidative markers. These observations come mainly from animal models and cultured cells, so the causal chain in humans is not firmly established. Whether the reported molecular changes translate into measurable clinical benefit is an open question. Reviews generally present the mechanism as plausible rather than demonstrated.
The peptide is prone to several degradation pathways. Oxidation of the methionine residue produces a sulfoxide that elutes close to the parent peak in many chromatographic systems. Hydrolysis of peptide bonds and deamidation of susceptible residues in related sequences also reduce purity over time. Lyophilised material kept dry at minus twenty degrees Celsius and shielded from light is the most stable form commonly described in laboratory practice.
Material sold for laboratory use varies widely in stated purity and documentation. A certificate of analysis should list the analytical method, the column and detector used, and the observed purity value. Independent verification by an outside laboratory is the practical way to confirm identity when documentation is absent or internally inconsistent. Regulatory status differs by country, and a product legal in one jurisdiction may be unapproved or controlled in another.
Identity and purity of semax are established with reversed-phase high-performance liquid chromatography coupled to ultraviolet detection, usually at 214 nanometres. Mass spectrometry, most often electrospray ionisation in positive mode, confirms the molecular mass and reveals truncated sequences. Amino acid analysis and peptide mapping after enzymatic digestion provide additional structural confirmation. Laboratories typically report purity as the percentage area of the main peak, a figure that does not capture isomeric or oxidised variants unless the method resolves them.
| Property | Value | Notes |
|---|---|---|
| Sequence | Met-Glu-His-Phe-Pro-Gly-Pro | Heptapeptide; ACTH(4-10) analog extended at C-terminus |
| Molecular mass | ~813.9 Da | Free peptide, unmodified |
| Appearance | White to off-white powder | Typical lyophilized solid |
| Solubility | Soluble in water and saline | Also soluble in common aqueous buffers |
| Storage (solid) | -20 °C, desiccated | Protect from moisture and repeated thawing |
Regulatory status differs sharply between jurisdictions. In Russia the peptide is registered as a prescription nasal preparation, while agencies such as the United States Food and Drug Administration have not approved it for any indication. Products sold elsewhere are typically labeled for laboratory research only, and such labels shift responsibility for safe handling to the purchaser. Because the same name covers pharmaceutical-grade nasal drops and bulk research powder, identity and purity documentation becomes the main practical concern when comparing sources.
Semax is a synthetic seven-amino-acid peptide whose sequence extends the ACTH(4-10) fragment with a C-terminal proline-glycine-proline tripeptide. The commonly cited sequence is Met-Glu-His-Phe-Pro-Gly-Pro, giving a molecular formula near C37H51N9O10S and a molecular weight close to 813.9 g/mol. It belongs to the broader class of synthetic ACTH fragments studied for central nervous system effects rather than for adrenal steroid stimulation. In practice the material appears as a lyophilized white powder for laboratory work or as a dilute saline solution in clinical settings.
Published studies are dominated by animal models of stroke, ischemia, and cognitive impairment, with a smaller number of human trials conducted in Russia. Many of the human reports are small, single-center, and published in Russian-language journals, which limits independent scrutiny. Outcome measures vary between studies and often rely on clinician-rated scales rather than objective biomarkers. Systematic reviews have noted the methodological weaknesses and called for larger, preregistered trials before firm conclusions can be drawn.
Claims about enhanced focus, memory, or mood in healthy people rest mostly on anecdotal reports and community discussion rather than on controlled data. It remains unclear whether any cognitive benefit observed in patients recovering from brain injury would extend to uninjured users. Dose-response relationships, long-term safety, and interactions with other drugs are not well characterized in the peer-reviewed literature. Questions about optimal route of administration and treatment duration likewise remain open.
Clinical reports describe use in ischaemic stroke, transient ischaemic attack, optic nerve conditions, and cognitive complaints, but most of these studies are small and were conducted in a single region. Systematic reviews have generally described the evidence base as limited in size and variable in methodological quality. Randomised controlled data suitable for international regulatory assessment are scarce. As a result, major treatment guidelines outside Russia do not include the peptide, and interest in it remains largely research-driven rather than routine clinical.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. It is described in the literature as an analogue of the ACTH(4–10) fragment, a short N-terminal portion of adrenocorticotropic hormone that retains some neurotropic activity without the full hormonal effects of the parent peptide. The molecule carries a methionine residue at the N-terminus and two proline residues near the C-terminus, features that shape both its interactions with receptor systems and its chemical stability. The free peptide corresponds to the formula C37H51N9O10S and a molecular mass near 813.9 Da.
Quality documentation for research-grade peptide usually includes a certificate of analysis stating purity, identity, and residual counterion content. Batch-to-batch variation in purity and salt form is a recognized issue, and comparisons across suppliers require attention to the exact counterion, for example acetate versus trifluoroacetate. Sequence verification by tandem mass spectrometry provides stronger evidence than a single mass measurement. For any study reporting biological results, the analytical method and the measured purity should be stated explicitly. Independent verification of supplier claims is considered good practice.
Semax is supplied as a lyophilized powder that appears white to off-white. It dissolves readily in water, phosphate-buffered saline, and other aqueous media, which simplifies preparation of working solutions for laboratory use. The nasal products registered in Russia are dilute aqueous solutions, typically around 0.1 percent peptide by weight. Organic solvents are rarely necessary and can complicate handling. Because the peptide is hygroscopic, weighing should be performed quickly and with minimal exposure to ambient humidity.
== External links == Media related to Pyridoxine at Wikimedia Commons "Pyridoxine". Drug Information Portal. U.S. National Library of Medicine. Archived from the original on 23 January 2017. "Pyridoxine mass spectrum". Golm Metabolome Database.
=== Recreational use === Zopiclone has the potential for non-medical use, dosage escalation, and drug dependence. It is taken orally and sometimes intravenously when used non-medically, and often combined with alcohol to achieve euphoria. Patients abusing the drug are also at risk of dependence. Withdrawal symptoms can be seen after long-term use of normal doses even after a gradual reduction regimen. The Compendium of Pharmaceuticals and Specialties recommends zopiclone prescriptions not exceed 7 to 10 days, owing to concerns of addiction, tolerance, and physical dependence. Two types of drug misuse can occur: either recreational misuse, wherein the drug is taken to achieve a high, or when the drug is continued long-term against medical advice. Zopiclone is as addictive as or may be more addictive than benzodiazepines. Those with a history of substance misuse or mental health disorders may be at an increased risk of high-dose zopiclone misuse. High-dose misuse of zopiclone and increasing popularity amongst people who use substances who have been prescribed with zopiclone was shown in the 1990s. The symptoms of zopiclone addiction can include depression, dysphoria, hopelessness, slow thoughts, social isolation, worrying, sexual anhedonia, and nervousness. Zopiclone and other sedative hypnotic drugs are detected frequently in cases of people suspected of driving under the influence of drugs. Other sedating drugs, including benzodiazepines and zolpidem, are also found in high numbers of suspected drugged drivers.
John Gross FRSL (12 March 1935 – 10 January 2011); editor of The Times Literary Supplement, senior book editor and book critic on The New York Times, theatre critic for The Sunday Telegraph; assistant editor on Encounter; literary editor of The New Statesman and Spectator; author of The Rise and Fall of the Man of Letters, James Joyce, Shylock: Four Hundred Years in the Life of a Legend; works as editor and anthologist include After Shakespeare: Writing inspired by the world's greatest author, The Oxford Book of Aphorisms, The Oxford Book of Essays, The Oxford Book of Comic Verse, The New Oxford Book of English Prose, The New Oxford Book of Literary Anecdotes, The Modern Movement, Dickens and the Twentieth Century, and The Oxford Book of Parodies; was trustee of London's National Portrait Gallery; served on the English Heritage advisory committee on blue plaques; advised British government on the award of public honours He served as chairman of the judges of the Booker Prize,; member of The Literary Society; director of Times Newspaper holdings, the publishers of The Times and The Sunday Times; married to Miriam Gross, literary editor; had two children, Tom Gross and Susanna Gross.
== Mechanotaxis in wound healing == In wound healing, fluid shear stress plays a large role in the mechanotaxis of endothelial cells to the wound site. The inner lining of blood vessels is composed of these endothelial cells, which means that these cells are continuously experiencing fluid shear stress from blood rushing through the vessels. This mechanical stress on the apical side of the endothelial cells leads to integrin signaling, which involves the recruitment of focal adhesion kinase (FAK), Shc, and Crk, and will lead to changes in cell-cell and cell-ECM adhesion. These changes involve lamellipodial protrusions and focal adhesion (FA) formation at the front of the cell, as well as the dismantling of FAs at the rear of the cell, and cause endothelial cells to move in the direction of the flow. Constant laminar flow has been found to improve cell migration in wounds and increases the rate of wound closure.
Sources: en.wikipedia.org
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
=== Low blood sugar === Hypoglycemia, whether known or suspected, can be treated with a mixture of sugar and water. If the patient is conscious, the initial dose of sugar and water can be given by mouth. Otherwise, they should receive glucose by intravenous or nasogastric tube. If seizures occur (and continue after glucose is given), rectal diazepam may be helpful. Blood sugar levels should be re-checked on two-hour intervals.
Caryophyllene (), more formally (−)-β-caryophyllene (BCP), is a natural bicyclic sesquiterpene that occurs widely in nature. Caryophyllene is notable for having a cyclobutane ring, as well as a trans-double bond in a 9-membered ring, both rarities in nature.
Valves in the perforating veins close when a calf muscle contracts, to prevent backflow from the deep veins to the superficial. There are more valves in the lower leg, due to increased gravitational pull, with the number decreasing as the veins travel to the hip. There are no valves in the veins of the thorax or abdomen. There is a valve at the junction of the inferior vena cava (one of the great vessels) and the right atrium known as the valve of inferior vena cava also known as the eustachian valve. This valve is an embryological remnant and is insignificant in the adult. However, when persistent it can cause problems.
Flower lotus cultivars are used exclusively for ornamental purpose, producing many flowers and the lowest plant height. The seed production of flower lotus is typically poor regarding yield and quality. Flower types differ in the number of petals (single petals, double petals, or multi-petals) and their colours range from single colour in white, yellow, pink, and red to bi-colour, most often of white petals with pink tips or highlights. One example of a flower lotus is Wanlian. Also known as bowl lotus, wanlians are any miniature cultivars of N. nucifera sized between 5 and 8 centimetres (2.0 and 3.1 in). Bowl lotuses come in various colours and numbers of petals, and they bloom longer than other species of lotus. But together with the rhizome, their seeds are often too small or too hard to be edible. The sacred lotus may be crossed with the yellow lotus to produce interspecific hybrids. A few cultivars have been produced with differing appearances.
Sources: en.wikipedia.org
== Calculation == As noted before, DIAAS considers the digestibility of individual essential amino acids (EAAs). The amounts of each amino acid in the test food and in the digested mixture at the end of the small intestine is subtracted to give the absorbed amount of each EAA ai. The value is divided by the total amount of protein in the test food to give the milligrams of each EAA absorbed for each gram of the protein Ai. One then looks up the desired reference pattern, which gives the amount of an EAA in 1 gram of the "reference protein" Ri. For each EAA, the "reference ratio" Ai/Ri is calculated. The final DIAAS is 100% times the lowest reference ratio. Amino acid digestibility is preferably scored using humans. If humans are not available, determination in growing pigs or growing rats are acceptable. For measurement in humans, a minimally invasive dual-tracer method has been developed for the DIAAS method.
Five-door four-seat hatchback Three-door four-seat hatchback Five-door four-seat station wagon (also as a van in Japan) Three-door four-seat station wagon Three-door two-seat van with an extended roof profile
Roderick MacKinnon (born February 19, 1956) is an American biophysicist, neuroscientist, and businessman. He is a professor of molecular neurobiology and biophysics at Rockefeller University who won the Nobel Prize in Chemistry together with Peter Agre in 2003 for his work on the structure and operation of ion channels.
Breakthrough T1D (formerly JDRF) is a type 1 diabetes (T1D) research and advocacy organization. Breakthrough T1D funds research for the development of new therapies and treatments for type 1 diabetes. The organization advocates for federal research funding toward new technologies and treatments and works with regulatory and policy officials to disburse funds. Breakthrough T1D also has partnerships with academia, industry, and clinicians to accelerate research into potential cures for T1D. The organization has been described as "the leading global organization funding T1D research".
Sources: en.wikipedia.org
Semax is a synthetic seven-amino-acid peptide derived from a fragment of corticotropin. It is used in Russia as a nasal preparation, while elsewhere it is studied as a research compound. It is not approved as a medicine in most countries.
Its sequence corresponds to the 4-10 region of corticotropin extended by three residues. This fragment lacks the region responsible for adrenal steroid release, so it is explored for neural rather than hormonal effects. The relationship explains the compound's classification among ACTH-derived peptides.
It holds approval in Russia for several neurological indications as a nasal spray or drop formulation. Regulatory agencies in the United States and the European Union have not approved it. Products sold elsewhere are generally labeled for research use only.
Reversed-phase high-performance liquid chromatography is the standard method, with detection in the ultraviolet range. Peak area percentage yields a purity figure for the main component. Mass spectrometry is normally run alongside to confirm molecular identity.